PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G32390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 388aa    MW: 39996.1 Da    PI: 6.8401
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G32390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-32116169255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OPUNC03G32390.1 116 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 169
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.35E-16113170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28114170IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23116169IPR006447Myb domain, plants
PfamPF002496.1E-8117168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MLQRNLPNLS LRISPPAVSS AAAVSSGAPT TAAAKTLSTG VITDAEGGGE VPFFGNPSSG  60
NEPPGLSLGL GPTTPAHADA ARGRHGDHLQ PQGCAFKRAA ARASLPAGSK RSVRAPRMRW  120
TTALHARFVH AVELLGGHER ATPKSVLELM NVKDLTLAHV KSHLQMYRTV KSTDRSSSHI  180
ASGESQLQLQ QQAGMEVAVE AAAGGGDGGG GGVVLPMMPA CDDMVGICSS PAAPAAATSS  240
AAAYFLCATT TSTATAPLVA VVPSLPAPTI PTRRTDQTPV LERGVAIVDS LHRCQKHNYS  300
PVLQDALQGA EEDHLITGRN LPIGGASGQA SIEAMAATNS SSPASSSPSL ASLEQLLPED  360
SFAPNLEISL GRQDWNMDHP EELSLKYL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084080.0AK108408.1 Oryza sativa Japonica Group cDNA clone:002-142-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629095.10.0PREDICTED: transcription factor LUX
TrEMBLA0A0E0KJF90.0A0A0E0KJF9_ORYPU; Uncharacterized protein
STRINGLOC_Os03g55760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65543750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.23e-40G2-like family protein